Anti PPIE pAb (ATL-HPA019357)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019357-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PPIE
Alternative Gene Name: CyP-33, MGC111222, MGC3736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028651: 96%, ENSRNOG00000014762: 94%
Entrez Gene ID: 10450
Uniprot ID: Q9UNP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGS |
| Gene Sequence | EGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGS |
| Gene ID - Mouse | ENSMUSG00000028651 |
| Gene ID - Rat | ENSRNOG00000014762 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPIE pAb (ATL-HPA019357) | |
| Datasheet | Anti PPIE pAb (ATL-HPA019357) Datasheet (External Link) |
| Vendor Page | Anti PPIE pAb (ATL-HPA019357) at Atlas Antibodies |
| Documents & Links for Anti PPIE pAb (ATL-HPA019357) | |
| Datasheet | Anti PPIE pAb (ATL-HPA019357) Datasheet (External Link) |
| Vendor Page | Anti PPIE pAb (ATL-HPA019357) |