Anti PPIE pAb (ATL-HPA019357)

Atlas Antibodies

Catalog No.:
ATL-HPA019357-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: peptidylprolyl isomerase E (cyclophilin E)
Gene Name: PPIE
Alternative Gene Name: CyP-33, MGC111222, MGC3736
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028651: 96%, ENSRNOG00000014762: 94%
Entrez Gene ID: 10450
Uniprot ID: Q9UNP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGS
Gene Sequence EGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGS
Gene ID - Mouse ENSMUSG00000028651
Gene ID - Rat ENSRNOG00000014762
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPIE pAb (ATL-HPA019357)
Datasheet Anti PPIE pAb (ATL-HPA019357) Datasheet (External Link)
Vendor Page Anti PPIE pAb (ATL-HPA019357) at Atlas Antibodies

Documents & Links for Anti PPIE pAb (ATL-HPA019357)
Datasheet Anti PPIE pAb (ATL-HPA019357) Datasheet (External Link)
Vendor Page Anti PPIE pAb (ATL-HPA019357)