Anti PPID pAb (ATL-HPA019692)

Atlas Antibodies

Catalog No.:
ATL-HPA019692-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: peptidylprolyl isomerase D
Gene Name: PPID
Alternative Gene Name: CYP-40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027804: 93%, ENSRNOG00000037230: 93%
Entrez Gene ID: 5481
Uniprot ID: Q08752
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAV
Gene Sequence IDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAV
Gene ID - Mouse ENSMUSG00000027804
Gene ID - Rat ENSRNOG00000037230
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPID pAb (ATL-HPA019692)
Datasheet Anti PPID pAb (ATL-HPA019692) Datasheet (External Link)
Vendor Page Anti PPID pAb (ATL-HPA019692) at Atlas Antibodies

Documents & Links for Anti PPID pAb (ATL-HPA019692)
Datasheet Anti PPID pAb (ATL-HPA019692) Datasheet (External Link)
Vendor Page Anti PPID pAb (ATL-HPA019692)