Anti PPFIBP1 pAb (ATL-HPA001924 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA001924-25
  • Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells and adnexal cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
  • Western blot analysis in human cell lines Caco-2 and HEK293 using Anti-PPFIBP1 antibody. Corresponding PPFIBP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: PTPRF interacting protein, binding protein 1 (liprin beta 1)
Gene Name: PPFIBP1
Alternative Gene Name: hSGT2, hSgt2p, L2, SGT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016487: 70%, ENSRNOG00000031709: 67%
Entrez Gene ID: 8496
Uniprot ID: Q86W92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSMETSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRA
Gene Sequence DAQGFSDLEKSPSPTPVMGSPSCDPFNTSVPEEFHTTILQVSIPSLLPATVSMETSEKSKLTPKPETSFEENDGNIILGATVDTQLCDKLLTSSLQKSSSLGNLKKETSDGEKETIQKTSEDRA
Gene ID - Mouse ENSMUSG00000016487
Gene ID - Rat ENSRNOG00000031709
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti PPFIBP1 pAb (ATL-HPA001924 w/enhanced validation)
Datasheet Anti PPFIBP1 pAb (ATL-HPA001924 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPFIBP1 pAb (ATL-HPA001924 w/enhanced validation)



Citations for Anti PPFIBP1 pAb (ATL-HPA001924 w/enhanced validation) – 1 Found
Xie, Xingqiao; Luo, Ling; Liang, Mingfu; Zhang, Wenchao; Zhang, Ting; Yu, Cong; Wei, Zhiyi. Structural basis of liprin-α-promoted LAR-RPTP clustering for modulation of phosphatase activity. Nature Communications. 2020;11(1):169.  PubMed