Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053419-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4
Gene Name: PPFIA4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026458: 93%, ENSRNOG00000003494: 91%
Entrez Gene ID: 8497
Uniprot ID: O75335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ
Gene Sequence ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ
Gene ID - Mouse ENSMUSG00000026458
Gene ID - Rat ENSRNOG00000003494
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation)
Datasheet Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation)
Datasheet Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation)
Citations for Anti PPFIA4 pAb (ATL-HPA053419 w/enhanced validation) – 1 Found
Zhao, Ru; Feng, Tingting; Gao, Lin; Sun, Feifei; Zhou, Qianqian; Wang, Xin; Liu, Junmei; Zhang, Wenbo; Wang, Meng; Xiong, Xueting; Jia, Wenqiao; Chen, Weiwen; Wang, Lin; Han, Bo. PPFIA4 promotes castration-resistant prostate cancer by enhancing mitochondrial metabolism through MTHFD2. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):125.  PubMed