Anti PPARGC1B pAb (ATL-HPA050543)

Atlas Antibodies

Catalog No.:
ATL-HPA050543-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: peroxisome proliferator-activated receptor gamma, coactivator 1 beta
Gene Name: PPARGC1B
Alternative Gene Name: PERC, PGC1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033871: 80%, ENSRNOG00000017503: 80%
Entrez Gene ID: 133522
Uniprot ID: Q86YN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKHSLGKEIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLR
Gene Sequence IKHSLGKEIALSLPSPEGLSLKATPGAAHKLPKKHPERSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLR
Gene ID - Mouse ENSMUSG00000033871
Gene ID - Rat ENSRNOG00000017503
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPARGC1B pAb (ATL-HPA050543)
Datasheet Anti PPARGC1B pAb (ATL-HPA050543) Datasheet (External Link)
Vendor Page Anti PPARGC1B pAb (ATL-HPA050543) at Atlas Antibodies

Documents & Links for Anti PPARGC1B pAb (ATL-HPA050543)
Datasheet Anti PPARGC1B pAb (ATL-HPA050543) Datasheet (External Link)
Vendor Page Anti PPARGC1B pAb (ATL-HPA050543)