Anti PPARG pAb (ATL-HPA063663 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA063663-25

Protein Description: peroxisome proliferator-activated receptor gamma
Gene Name: PPARG
Alternative Gene Name: NR1C3, PPARG1, PPARG2, PPARgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000440: 98%, ENSRNOG00000008839: 98%
Entrez Gene ID: 5468
Uniprot ID: P37231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC
• Gene Sequence: DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC
• Gene ID - Mouse: ENSMUSG00000000440
• Gene ID - Rat: ENSRNOG00000008839
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.