Anti PPARG pAb (ATL-HPA063663 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA063663-25
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleus.
  • Western blot analysis in human cell lines RT-4 and U-251MG using Anti-PPARG antibody. Corresponding PPARG RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: peroxisome proliferator-activated receptor gamma
Gene Name: PPARG
Alternative Gene Name: NR1C3, PPARG1, PPARG2, PPARgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000440: 98%, ENSRNOG00000008839: 98%
Entrez Gene ID: 5468
Uniprot ID: P37231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC
Gene Sequence DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC
Gene ID - Mouse ENSMUSG00000000440
Gene ID - Rat ENSRNOG00000008839
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PPARG pAb (ATL-HPA063663 w/enhanced validation)
Datasheet Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PPARG pAb (ATL-HPA063663 w/enhanced validation)
Datasheet Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PPARG pAb (ATL-HPA063663 w/enhanced validation)