Anti PPARG pAb (ATL-HPA063663 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063663-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PPARG
Alternative Gene Name: NR1C3, PPARG1, PPARG2, PPARgamma
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000440: 98%, ENSRNOG00000008839: 98%
Entrez Gene ID: 5468
Uniprot ID: P37231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC |
Gene Sequence | DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC |
Gene ID - Mouse | ENSMUSG00000000440 |
Gene ID - Rat | ENSRNOG00000008839 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) | |
Datasheet | Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) | |
Datasheet | Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti PPARG pAb (ATL-HPA063663 w/enhanced validation) |