Anti PPARA pAb (ATL-HPA067049)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067049-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: PPARA
Alternative Gene Name: hPPAR, NR1C1, PPAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022383: 87%, ENSRNOG00000021463: 89%
Entrez Gene ID: 5465
Uniprot ID: Q07869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTE |
| Gene Sequence | HDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTE |
| Gene ID - Mouse | ENSMUSG00000022383 |
| Gene ID - Rat | ENSRNOG00000021463 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PPARA pAb (ATL-HPA067049) | |
| Datasheet | Anti PPARA pAb (ATL-HPA067049) Datasheet (External Link) |
| Vendor Page | Anti PPARA pAb (ATL-HPA067049) at Atlas Antibodies |
| Documents & Links for Anti PPARA pAb (ATL-HPA067049) | |
| Datasheet | Anti PPARA pAb (ATL-HPA067049) Datasheet (External Link) |
| Vendor Page | Anti PPARA pAb (ATL-HPA067049) |