Anti PPARA pAb (ATL-HPA058901)

Atlas Antibodies

Catalog No.:
ATL-HPA058901-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: peroxisome proliferator-activated receptor alpha
Gene Name: PPARA
Alternative Gene Name: hPPAR, NR1C1, PPAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022383: 91%, ENSRNOG00000021463: 93%
Entrez Gene ID: 5465
Uniprot ID: Q07869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN
Gene Sequence FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN
Gene ID - Mouse ENSMUSG00000022383
Gene ID - Rat ENSRNOG00000021463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PPARA pAb (ATL-HPA058901)
Datasheet Anti PPARA pAb (ATL-HPA058901) Datasheet (External Link)
Vendor Page Anti PPARA pAb (ATL-HPA058901) at Atlas Antibodies

Documents & Links for Anti PPARA pAb (ATL-HPA058901)
Datasheet Anti PPARA pAb (ATL-HPA058901) Datasheet (External Link)
Vendor Page Anti PPARA pAb (ATL-HPA058901)