Anti PPARA pAb (ATL-HPA058901)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058901-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: PPARA
Alternative Gene Name: hPPAR, NR1C1, PPAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022383: 91%, ENSRNOG00000021463: 93%
Entrez Gene ID: 5465
Uniprot ID: Q07869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN |
Gene Sequence | FGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKN |
Gene ID - Mouse | ENSMUSG00000022383 |
Gene ID - Rat | ENSRNOG00000021463 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PPARA pAb (ATL-HPA058901) | |
Datasheet | Anti PPARA pAb (ATL-HPA058901) Datasheet (External Link) |
Vendor Page | Anti PPARA pAb (ATL-HPA058901) at Atlas Antibodies |
Documents & Links for Anti PPARA pAb (ATL-HPA058901) | |
Datasheet | Anti PPARA pAb (ATL-HPA058901) Datasheet (External Link) |
Vendor Page | Anti PPARA pAb (ATL-HPA058901) |