Anti PP2D1 pAb (ATL-HPA066083)

Atlas Antibodies

SKU: ATL-HPA066083-25

• 

Protein Description: protein phosphatase 2C-like domain containing 1
Gene Name: PP2D1
Alternative Gene Name: C3orf48, FLJ25449
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044957: 72%, ENSRNOG00000004719: 71%
Entrez Gene ID: 151649
Uniprot ID: A8MPX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGC
• Gene Sequence: PSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRVQWSGC
• Gene ID - Mouse: ENSMUSG00000044957
• Gene ID - Rat: ENSRNOG00000004719
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.