Anti POU5F2 pAb (ATL-HPA077615)

Atlas Antibodies

Catalog No.:
ATL-HPA077615-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: POU domain class 5, transcription factor 2
Gene Name: POU5F2
Alternative Gene Name: FLJ25680, SPRM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093668: 73%, ENSRNOG00000062285: 74%
Entrez Gene ID: 134187
Uniprot ID: Q8N7G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKP
Gene Sequence QQLSVANMWKLRPLLKKWLKEVEAENLLGLCKMEMILQQSGKWRRASRERRIGNSLEKFFQRCPKP
Gene ID - Mouse ENSMUSG00000093668
Gene ID - Rat ENSRNOG00000062285
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POU5F2 pAb (ATL-HPA077615)
Datasheet Anti POU5F2 pAb (ATL-HPA077615) Datasheet (External Link)
Vendor Page Anti POU5F2 pAb (ATL-HPA077615) at Atlas Antibodies

Documents & Links for Anti POU5F2 pAb (ATL-HPA077615)
Datasheet Anti POU5F2 pAb (ATL-HPA077615) Datasheet (External Link)
Vendor Page Anti POU5F2 pAb (ATL-HPA077615)