Anti POU5F1B pAb (ATL-HPA058267)

Atlas Antibodies

Catalog No.: ATL-HPA058267-25

Protein Description: POU class 5 homeobox 1B
Gene Name: POU5F1B
Alternative Gene Name: OTF3C, OTF3P1, POU5F1P1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024406: 76%, ENSRNOG00000046487: 76%
Entrez Gene ID: 5462
Uniprot ID: Q06416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
• Gene Sequence: VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
• Gene ID - Mouse: ENSMUSG00000024406
• Gene ID - Rat: ENSRNOG00000046487
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.