Anti POU5F1B pAb (ATL-HPA058267)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058267-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: POU5F1B
Alternative Gene Name: OTF3C, OTF3P1, POU5F1P1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024406: 76%, ENSRNOG00000046487: 76%
Entrez Gene ID: 5462
Uniprot ID: Q06416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV |
Gene Sequence | VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV |
Gene ID - Mouse | ENSMUSG00000024406 |
Gene ID - Rat | ENSRNOG00000046487 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti POU5F1B pAb (ATL-HPA058267) | |
Datasheet | Anti POU5F1B pAb (ATL-HPA058267) Datasheet (External Link) |
Vendor Page | Anti POU5F1B pAb (ATL-HPA058267) at Atlas Antibodies |
Documents & Links for Anti POU5F1B pAb (ATL-HPA058267) | |
Datasheet | Anti POU5F1B pAb (ATL-HPA058267) Datasheet (External Link) |
Vendor Page | Anti POU5F1B pAb (ATL-HPA058267) |