Anti POU5F1B pAb (ATL-HPA058267)

Atlas Antibodies

Catalog No.:
ATL-HPA058267-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: POU class 5 homeobox 1B
Gene Name: POU5F1B
Alternative Gene Name: OTF3C, OTF3P1, POU5F1P1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024406: 76%, ENSRNOG00000046487: 76%
Entrez Gene ID: 5462
Uniprot ID: Q06416
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
Gene Sequence VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
Gene ID - Mouse ENSMUSG00000024406
Gene ID - Rat ENSRNOG00000046487
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POU5F1B pAb (ATL-HPA058267)
Datasheet Anti POU5F1B pAb (ATL-HPA058267) Datasheet (External Link)
Vendor Page Anti POU5F1B pAb (ATL-HPA058267) at Atlas Antibodies

Documents & Links for Anti POU5F1B pAb (ATL-HPA058267)
Datasheet Anti POU5F1B pAb (ATL-HPA058267) Datasheet (External Link)
Vendor Page Anti POU5F1B pAb (ATL-HPA058267)