Anti POU3F4 pAb (ATL-HPA062295)

Atlas Antibodies

SKU: ATL-HPA062295-25

• 
• 

Protein Description: POU class 3 homeobox 4
Gene Name: POU3F4
Alternative Gene Name: BRN4, DFN3, DFNX2, OTF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056854: 100%, ENSRNOG00000002784: 100%
Entrez Gene ID: 5456
Uniprot ID: P49335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR
• Gene Sequence: SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR
• Gene ID - Mouse: ENSMUSG00000056854
• Gene ID - Rat: ENSRNOG00000002784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.