Anti POU3F4 pAb (ATL-HPA062295)

Atlas Antibodies

Catalog No.:
ATL-HPA062295-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: POU class 3 homeobox 4
Gene Name: POU3F4
Alternative Gene Name: BRN4, DFN3, DFNX2, OTF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056854: 100%, ENSRNOG00000002784: 100%
Entrez Gene ID: 5456
Uniprot ID: P49335
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR
Gene Sequence SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR
Gene ID - Mouse ENSMUSG00000056854
Gene ID - Rat ENSRNOG00000002784
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POU3F4 pAb (ATL-HPA062295)
Datasheet Anti POU3F4 pAb (ATL-HPA062295) Datasheet (External Link)
Vendor Page Anti POU3F4 pAb (ATL-HPA062295) at Atlas Antibodies

Documents & Links for Anti POU3F4 pAb (ATL-HPA062295)
Datasheet Anti POU3F4 pAb (ATL-HPA062295) Datasheet (External Link)
Vendor Page Anti POU3F4 pAb (ATL-HPA062295)