Anti POU2F2 pAb (ATL-HPA073998 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA073998-100

• 
• 

Protein Description: POU class 2 homeobox 2
Gene Name: POU2F2
Alternative Gene Name: OCT2, OTF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008496: 94%, ENSRNOG00000055650: 94%
Entrez Gene ID: 5452
Uniprot ID: P09086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSP
• Gene Sequence: MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSP
• Gene ID - Mouse: ENSMUSG00000008496
• Gene ID - Rat: ENSRNOG00000055650
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.