Anti POU2F2 pAb (ATL-HPA062096)

Atlas Antibodies

SKU:
ATL-HPA062096-25
  • Immunofluorescent staining of human cell line BJ shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: POU class 2 homeobox 2
Gene Name: POU2F2
Alternative Gene Name: OCT2, OTF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008496: 94%, ENSRNOG00000055650: 94%
Entrez Gene ID: 5452
Uniprot ID: P09086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSP
Gene Sequence MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSP
Gene ID - Mouse ENSMUSG00000008496
Gene ID - Rat ENSRNOG00000055650
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti POU2F2 pAb (ATL-HPA062096)
Datasheet Anti POU2F2 pAb (ATL-HPA062096) Datasheet (External Link)
Vendor Page Anti POU2F2 pAb (ATL-HPA062096) at Atlas Antibodies

Documents & Links for Anti POU2F2 pAb (ATL-HPA062096)
Datasheet Anti POU2F2 pAb (ATL-HPA062096) Datasheet (External Link)
Vendor Page Anti POU2F2 pAb (ATL-HPA062096)