Anti POT1 pAb (ATL-HPA068538)

Atlas Antibodies

Catalog No.: ATL-HPA068538-25

Protein Description: protection of telomeres 1
Gene Name: POT1
Alternative Gene Name: DKFZp586D211, hPot1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098835: 76%, ENSRNOG00000019986: 74%
Entrez Gene ID: 25913
Uniprot ID: Q9NUX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
• Gene Sequence: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
• Gene ID - Mouse: ENSMUSG00000098835
• Gene ID - Rat: ENSRNOG00000019986
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.