Anti POT1 pAb (ATL-HPA068538)

Atlas Antibodies

Catalog No.:
ATL-HPA068538-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: protection of telomeres 1
Gene Name: POT1
Alternative Gene Name: DKFZp586D211, hPot1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098835: 76%, ENSRNOG00000019986: 74%
Entrez Gene ID: 25913
Uniprot ID: Q9NUX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
Gene Sequence LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
Gene ID - Mouse ENSMUSG00000098835
Gene ID - Rat ENSRNOG00000019986
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POT1 pAb (ATL-HPA068538)
Datasheet Anti POT1 pAb (ATL-HPA068538) Datasheet (External Link)
Vendor Page Anti POT1 pAb (ATL-HPA068538) at Atlas Antibodies

Documents & Links for Anti POT1 pAb (ATL-HPA068538)
Datasheet Anti POT1 pAb (ATL-HPA068538) Datasheet (External Link)
Vendor Page Anti POT1 pAb (ATL-HPA068538)