Anti POP7 pAb (ATL-HPA021007 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021007-25

Protein Description: processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
Gene Name: POP7
Alternative Gene Name: RPP2, RPP20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029715: 97%, ENSRNOG00000025310: 99%
Entrez Gene ID: 10248
Uniprot ID: O75817
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
• Gene Sequence: HGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
• Gene ID - Mouse: ENSMUSG00000029715
• Gene ID - Rat: ENSRNOG00000025310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.