Anti POP1 pAb (ATL-HPA066194)

Atlas Antibodies

Catalog No.:
ATL-HPA066194-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: POP1 homolog, ribonuclease P/MRP subunit
Gene Name: POP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022325: 88%, ENSRNOG00000005243: 91%
Entrez Gene ID: 10940
Uniprot ID: Q99575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRR
Gene Sequence IPILLIQQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVPGDFPDCPAGMLFAEEQAKNLLEKYKRR
Gene ID - Mouse ENSMUSG00000022325
Gene ID - Rat ENSRNOG00000005243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POP1 pAb (ATL-HPA066194)
Datasheet Anti POP1 pAb (ATL-HPA066194) Datasheet (External Link)
Vendor Page Anti POP1 pAb (ATL-HPA066194) at Atlas Antibodies

Documents & Links for Anti POP1 pAb (ATL-HPA066194)
Datasheet Anti POP1 pAb (ATL-HPA066194) Datasheet (External Link)
Vendor Page Anti POP1 pAb (ATL-HPA066194)