Anti POLRMT pAb (ATL-HPA006366)

Atlas Antibodies

Catalog No.: ATL-HPA006366-25

Protein Description: polymerase (RNA) mitochondrial (DNA directed)
Gene Name: POLRMT
Alternative Gene Name: APOLMT, h-mtRPOL, MTRNAP, MTRPOL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020329: 68%, ENSRNOG00000024879: 65%
Entrez Gene ID: 5442
Uniprot ID: O00411
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH
• Gene Sequence: ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH
• Gene ID - Mouse: ENSMUSG00000020329
• Gene ID - Rat: ENSRNOG00000024879
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti POLRMT pAb (ATL-HPA006366) – 3 Found

Salem, Ahmed F; Whitaker-Menezes, Diana; Howell, Anthony; Sotgia, Federica; Lisanti, Michael P. Mitochondrial biogenesis in epithelial cancer cells promotes breast cancer tumor growth and confers autophagy resistance. Cell Cycle (Georgetown, Tex.). 2012;11(22):4174-80. 

Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401. 

Žaja, R; Aydin, G; Lippok, B E; Feederle, R; Lüscher, B; Feijs, K L H. Comparative analysis of MACROD1, MACROD2 and TARG1 expression, localisation and interactome. Scientific Reports. 2020;10(1):8286.