Anti POLR3GL pAb (ATL-HPA027288 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027288-25

Protein Description: polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like
Gene Name: POLR3GL
Alternative Gene Name: flj32422, MGC3200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028104: 97%, ENSRNOG00000021209: 97%
Entrez Gene ID: 84265
Uniprot ID: Q9BT43
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
• Gene Sequence: VGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLPYFIRPAVPKRDVERYSD
• Gene ID - Mouse: ENSMUSG00000028104
• Gene ID - Rat: ENSRNOG00000021209
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti POLR3GL pAb (ATL-HPA027288 w/enhanced validation) – 1 Found

Petrie, John L; Swan, Caroline; Ingram, Richard M; Frame, Fiona M; Collins, Anne T; Dumay-Odelot, Hélène; Teichmann, Martin; Maitland, Norman J; White, Robert J. Effects on prostate cancer cells of targeting RNA polymerase III. Nucleic Acids Research. 2019;47(8):3937-3956.