Anti POLR3F pAb (ATL-HPA072298)

Atlas Antibodies

Catalog No.:
ATL-HPA072298-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa
Gene Name: POLR3F
Alternative Gene Name: RPC39, RPC6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027427: 99%, ENSRNOG00000007548: 99%
Entrez Gene ID: 10621
Uniprot ID: Q9H1D9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQR
Gene Sequence IKAVKSVAASKKKVYMLYNLQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFLQSKAETARESKQNPMIQR
Gene ID - Mouse ENSMUSG00000027427
Gene ID - Rat ENSRNOG00000007548
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLR3F pAb (ATL-HPA072298)
Datasheet Anti POLR3F pAb (ATL-HPA072298) Datasheet (External Link)
Vendor Page Anti POLR3F pAb (ATL-HPA072298) at Atlas Antibodies

Documents & Links for Anti POLR3F pAb (ATL-HPA072298)
Datasheet Anti POLR3F pAb (ATL-HPA072298) Datasheet (External Link)
Vendor Page Anti POLR3F pAb (ATL-HPA072298)