Anti POLR2M pAb (ATL-HPA068141)

Atlas Antibodies

SKU: ATL-HPA068141-25

• 
• 

Protein Description: polymerase (RNA) II (DNA directed) polypeptide M
Gene Name: POLR2M
Alternative Gene Name: GCOM1, Gdown, Gdown1, GRINL1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032199: 67%, ENSRNOG00000057676: 70%
Entrez Gene ID: 81488
Uniprot ID: P0CAP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK
• Gene Sequence: SSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK
• Gene ID - Mouse: ENSMUSG00000032199
• Gene ID - Rat: ENSRNOG00000057676
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.