Anti POLR2M pAb (ATL-HPA068141)

Atlas Antibodies

Catalog No.:
ATL-HPA068141-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: polymerase (RNA) II (DNA directed) polypeptide M
Gene Name: POLR2M
Alternative Gene Name: GCOM1, Gdown, Gdown1, GRINL1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032199: 67%, ENSRNOG00000057676: 70%
Entrez Gene ID: 81488
Uniprot ID: P0CAP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK
Gene Sequence SSQAEDTSSSFDNLFIDRLQRITIADQGEQQSEENASTKNLTGLSSGTEKKPHYMEVLEMRAK
Gene ID - Mouse ENSMUSG00000032199
Gene ID - Rat ENSRNOG00000057676
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLR2M pAb (ATL-HPA068141)
Datasheet Anti POLR2M pAb (ATL-HPA068141) Datasheet (External Link)
Vendor Page Anti POLR2M pAb (ATL-HPA068141) at Atlas Antibodies

Documents & Links for Anti POLR2M pAb (ATL-HPA068141)
Datasheet Anti POLR2M pAb (ATL-HPA068141) Datasheet (External Link)
Vendor Page Anti POLR2M pAb (ATL-HPA068141)