Anti POLR2K pAb (ATL-HPA063185)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063185-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: POLR2K
Alternative Gene Name: RPB10alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045996: 100%, ENSRNOG00000010408: 100%
Entrez Gene ID: 5440
Uniprot ID: P53803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV |
| Gene Sequence | DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV |
| Gene ID - Mouse | ENSMUSG00000045996 |
| Gene ID - Rat | ENSRNOG00000010408 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti POLR2K pAb (ATL-HPA063185) | |
| Datasheet | Anti POLR2K pAb (ATL-HPA063185) Datasheet (External Link) |
| Vendor Page | Anti POLR2K pAb (ATL-HPA063185) at Atlas Antibodies |
| Documents & Links for Anti POLR2K pAb (ATL-HPA063185) | |
| Datasheet | Anti POLR2K pAb (ATL-HPA063185) Datasheet (External Link) |
| Vendor Page | Anti POLR2K pAb (ATL-HPA063185) |