Anti POLR2K pAb (ATL-HPA063185)

Atlas Antibodies

Catalog No.:
ATL-HPA063185-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa
Gene Name: POLR2K
Alternative Gene Name: RPB10alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045996: 100%, ENSRNOG00000010408: 100%
Entrez Gene ID: 5440
Uniprot ID: P53803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV
Gene Sequence DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV
Gene ID - Mouse ENSMUSG00000045996
Gene ID - Rat ENSRNOG00000010408
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLR2K pAb (ATL-HPA063185)
Datasheet Anti POLR2K pAb (ATL-HPA063185) Datasheet (External Link)
Vendor Page Anti POLR2K pAb (ATL-HPA063185) at Atlas Antibodies

Documents & Links for Anti POLR2K pAb (ATL-HPA063185)
Datasheet Anti POLR2K pAb (ATL-HPA063185) Datasheet (External Link)
Vendor Page Anti POLR2K pAb (ATL-HPA063185)