Anti POLR2K pAb (ATL-HPA063185)

Atlas Antibodies

SKU: ATL-HPA063185-25

• 

Protein Description: polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa
Gene Name: POLR2K
Alternative Gene Name: RPB10alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045996: 100%, ENSRNOG00000010408: 100%
Entrez Gene ID: 5440
Uniprot ID: P53803
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV
• Gene Sequence: DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV
• Gene ID - Mouse: ENSMUSG00000045996
• Gene ID - Rat: ENSRNOG00000010408
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.