Anti POLR2I pAb (ATL-HPA035632)

Atlas Antibodies

Catalog No.:
ATL-HPA035632-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa
Gene Name: POLR2I
Alternative Gene Name: hRPB14.5, RPB9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019738: 100%, ENSRNOG00000050560: 100%
Entrez Gene ID: 5438
Uniprot ID: P36954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCT
Gene Sequence DELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCT
Gene ID - Mouse ENSMUSG00000019738
Gene ID - Rat ENSRNOG00000050560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLR2I pAb (ATL-HPA035632)
Datasheet Anti POLR2I pAb (ATL-HPA035632) Datasheet (External Link)
Vendor Page Anti POLR2I pAb (ATL-HPA035632) at Atlas Antibodies

Documents & Links for Anti POLR2I pAb (ATL-HPA035632)
Datasheet Anti POLR2I pAb (ATL-HPA035632) Datasheet (External Link)
Vendor Page Anti POLR2I pAb (ATL-HPA035632)