Anti POLR2D pAb (ATL-HPA046092)

Atlas Antibodies

SKU:
ATL-HPA046092-25
  • Immunohistochemical staining of human cervix, uterine shows nuclear positivity in squamous epithelial cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polymerase (RNA) II (DNA directed) polypeptide D
Gene Name: POLR2D
Alternative Gene Name: RBP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024258: 100%, ENSRNOG00000016231: 100%
Entrez Gene ID: 5433
Uniprot ID: O15514
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Gene Sequence NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Gene ID - Mouse ENSMUSG00000024258
Gene ID - Rat ENSRNOG00000016231
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti POLR2D pAb (ATL-HPA046092)
Datasheet Anti POLR2D pAb (ATL-HPA046092) Datasheet (External Link)
Vendor Page Anti POLR2D pAb (ATL-HPA046092) at Atlas Antibodies

Documents & Links for Anti POLR2D pAb (ATL-HPA046092)
Datasheet Anti POLR2D pAb (ATL-HPA046092) Datasheet (External Link)
Vendor Page Anti POLR2D pAb (ATL-HPA046092)