Anti POLR2A pAb (ATL-HPA053012)

Atlas Antibodies

Catalog No.:
ATL-HPA053012-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: polymerase (RNA) II (DNA directed) polypeptide A, 220kDa
Gene Name: POLR2A
Alternative Gene Name: POLR2, POLRA, RPB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005198: 100%, ENSRNOG00000028834: 100%
Entrez Gene ID: 5430
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLS
Gene Sequence GFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLS
Gene ID - Mouse ENSMUSG00000005198
Gene ID - Rat ENSRNOG00000028834
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLR2A pAb (ATL-HPA053012)
Datasheet Anti POLR2A pAb (ATL-HPA053012) Datasheet (External Link)
Vendor Page Anti POLR2A pAb (ATL-HPA053012) at Atlas Antibodies

Documents & Links for Anti POLR2A pAb (ATL-HPA053012)
Datasheet Anti POLR2A pAb (ATL-HPA053012) Datasheet (External Link)
Vendor Page Anti POLR2A pAb (ATL-HPA053012)