Anti POLM pAb (ATL-HPA066007)

Atlas Antibodies

SKU:
ATL-HPA066007-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & cytosol.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polymerase (DNA directed), mu
Gene Name: POLM
Alternative Gene Name: Tdt-N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020474: 70%, ENSRNOG00000013647: 68%
Entrez Gene ID: 27434
Uniprot ID: Q9NP87
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
Gene Sequence SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG
Gene ID - Mouse ENSMUSG00000020474
Gene ID - Rat ENSRNOG00000013647
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti POLM pAb (ATL-HPA066007)
Datasheet Anti POLM pAb (ATL-HPA066007) Datasheet (External Link)
Vendor Page Anti POLM pAb (ATL-HPA066007) at Atlas Antibodies

Documents & Links for Anti POLM pAb (ATL-HPA066007)
Datasheet Anti POLM pAb (ATL-HPA066007) Datasheet (External Link)
Vendor Page Anti POLM pAb (ATL-HPA066007)