Anti POLL pAb (ATL-HPA076828)

Atlas Antibodies

Catalog No.:
ATL-HPA076828-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DNA polymerase lambda
Gene Name: POLL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025218: 90%, ENSRNOG00000016748: 91%
Entrez Gene ID: 27343
Uniprot ID: Q9UGP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD
Gene Sequence VVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERD
Gene ID - Mouse ENSMUSG00000025218
Gene ID - Rat ENSRNOG00000016748
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLL pAb (ATL-HPA076828)
Datasheet Anti POLL pAb (ATL-HPA076828) Datasheet (External Link)
Vendor Page Anti POLL pAb (ATL-HPA076828) at Atlas Antibodies

Documents & Links for Anti POLL pAb (ATL-HPA076828)
Datasheet Anti POLL pAb (ATL-HPA076828) Datasheet (External Link)
Vendor Page Anti POLL pAb (ATL-HPA076828)