Anti POLH pAb (ATL-HPA026762)

Atlas Antibodies

Catalog No.: ATL-HPA026762-25

Protein Description: polymerase (DNA directed), eta
Gene Name: POLH
Alternative Gene Name: RAD30A, XP-V
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023953: 91%, ENSRNOG00000019195: 87%
Entrez Gene ID: 5429
Uniprot ID: Q9Y253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSL
• Gene Sequence: ERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSL
• Gene ID - Mouse: ENSMUSG00000023953
• Gene ID - Rat: ENSRNOG00000019195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.