Anti POLG pAb (ATL-HPA056821)

Atlas Antibodies

Catalog No.:
ATL-HPA056821-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: polymerase (DNA directed), gamma
Gene Name: POLG
Alternative Gene Name: POLG1, POLGA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039176: 93%, ENSRNOG00000032293: 91%
Entrez Gene ID: 5428
Uniprot ID: P54098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMD
Gene Sequence FVKGTMKDIRENFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMD
Gene ID - Mouse ENSMUSG00000039176
Gene ID - Rat ENSRNOG00000032293
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLG pAb (ATL-HPA056821)
Datasheet Anti POLG pAb (ATL-HPA056821) Datasheet (External Link)
Vendor Page Anti POLG pAb (ATL-HPA056821) at Atlas Antibodies

Documents & Links for Anti POLG pAb (ATL-HPA056821)
Datasheet Anti POLG pAb (ATL-HPA056821) Datasheet (External Link)
Vendor Page Anti POLG pAb (ATL-HPA056821)