Anti POLE4 pAb (ATL-HPA071815)

Atlas Antibodies

Catalog No.:
ATL-HPA071815-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: polymerase (DNA-directed), epsilon 4, accessory subunit
Gene Name: POLE4
Alternative Gene Name: p12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030042: 100%, ENSRNOG00000006102: 100%
Entrez Gene ID: 56655
Uniprot ID: Q9NR33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
Gene Sequence GQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
Gene ID - Mouse ENSMUSG00000030042
Gene ID - Rat ENSRNOG00000006102
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLE4 pAb (ATL-HPA071815)
Datasheet Anti POLE4 pAb (ATL-HPA071815) Datasheet (External Link)
Vendor Page Anti POLE4 pAb (ATL-HPA071815) at Atlas Antibodies

Documents & Links for Anti POLE4 pAb (ATL-HPA071815)
Datasheet Anti POLE4 pAb (ATL-HPA071815) Datasheet (External Link)
Vendor Page Anti POLE4 pAb (ATL-HPA071815)