Anti POLE pAb (ATL-HPA058210)

Atlas Antibodies

Catalog No.: ATL-HPA058210-25

Protein Description: polymerase (DNA directed), epsilon, catalytic subunit
Gene Name: POLE
Alternative Gene Name: POLE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007080: 93%, ENSRNOG00000037449: 93%
Entrez Gene ID: 5426
Uniprot ID: Q07864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HLQRHNHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTILQSHHVNDMEGADSMGISFDVIQ
• Gene Sequence: HLQRHNHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTILQSHHVNDMEGADSMGISFDVIQ
• Gene ID - Mouse: ENSMUSG00000007080
• Gene ID - Rat: ENSRNOG00000037449
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.