Anti POLE pAb (ATL-HPA058210)

Atlas Antibodies

SKU:
ATL-HPA058210-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polymerase (DNA directed), epsilon, catalytic subunit
Gene Name: POLE
Alternative Gene Name: POLE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007080: 93%, ENSRNOG00000037449: 93%
Entrez Gene ID: 5426
Uniprot ID: Q07864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLQRHNHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTILQSHHVNDMEGADSMGISFDVIQ
Gene Sequence HLQRHNHLLWLSPTARPDLGGKEADDNCLVMEFDDQATVEINSSGCYSTVCVELDLQNLAVNTILQSHHVNDMEGADSMGISFDVIQ
Gene ID - Mouse ENSMUSG00000007080
Gene ID - Rat ENSRNOG00000037449
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti POLE pAb (ATL-HPA058210)
Datasheet Anti POLE pAb (ATL-HPA058210) Datasheet (External Link)
Vendor Page Anti POLE pAb (ATL-HPA058210) at Atlas Antibodies

Documents & Links for Anti POLE pAb (ATL-HPA058210)
Datasheet Anti POLE pAb (ATL-HPA058210) Datasheet (External Link)
Vendor Page Anti POLE pAb (ATL-HPA058210)