Anti POLD4 pAb (ATL-HPA071529)

Atlas Antibodies

Catalog No.:
ATL-HPA071529-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: polymerase (DNA-directed), delta 4, accessory subunit
Gene Name: POLD4
Alternative Gene Name: p12, POLDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097508: 84%, ENSRNOG00000018765: 86%
Entrez Gene ID: 57804
Uniprot ID: Q9HCU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYP
Gene Sequence WQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYP
Gene ID - Mouse ENSMUSG00000097508
Gene ID - Rat ENSRNOG00000018765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLD4 pAb (ATL-HPA071529)
Datasheet Anti POLD4 pAb (ATL-HPA071529) Datasheet (External Link)
Vendor Page Anti POLD4 pAb (ATL-HPA071529) at Atlas Antibodies

Documents & Links for Anti POLD4 pAb (ATL-HPA071529)
Datasheet Anti POLD4 pAb (ATL-HPA071529) Datasheet (External Link)
Vendor Page Anti POLD4 pAb (ATL-HPA071529)