Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058846-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: POLD3
Alternative Gene Name: KIAA0039, P66, P68, PPP1R128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030726: 75%, ENSRNOG00000018411: 75%
Entrez Gene ID: 10714
Uniprot ID: Q15054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY |
| Gene Sequence | SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY |
| Gene ID - Mouse | ENSMUSG00000030726 |
| Gene ID - Rat | ENSRNOG00000018411 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation) | |
| Datasheet | Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation) | |
| Datasheet | Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation) |
| Citations for Anti POLD3 pAb (ATL-HPA058846 w/enhanced validation) – 1 Found |
| Brosnan-Cashman, Jacqueline A; Yuan, Ming; Graham, Mindy K; Rizzo, Anthony J; Myers, Kaylar M; Davis, Christine; Zhang, Rebecca; Esopi, David M; Raabe, Eric H; Eberhart, Charles G; Heaphy, Christopher M; Meeker, Alan K. ATRX loss induces multiple hallmarks of the alternative lengthening of telomeres (ALT) phenotype in human glioma cell lines in a cell line-specific manner. Plos One. 13(9):e0204159. PubMed |