Anti POLD2 pAb (ATL-HPA026745 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026745-25

Protein Description: polymerase (DNA directed), delta 2, accessory subunit
Gene Name: POLD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020471: 94%, ENSRNOG00000014098: 96%
Entrez Gene ID: 5425
Uniprot ID: P49005
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQC
• Gene Sequence: PRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQC
• Gene ID - Mouse: ENSMUSG00000020471
• Gene ID - Rat: ENSRNOG00000014098
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti POLD2 pAb (ATL-HPA026745 w/enhanced validation) – 4 Found

Fan, Yilin; Köberlin, Marielle S; Ratnayeke, Nalin; Liu, Chad; Deshpande, Madhura; Gerhardt, Jeannine; Meyer, Tobias. LRR1-mediated replisome disassembly promotes DNA replication by recycling replisome components. The Journal Of Cell Biology. 2021;220(8) 

Conde, Cecilia Domínguez; Petronczki, Özlem Yüce; Baris, Safa; Willmann, Katharina L; Girardi, Enrico; Salzer, Elisabeth; Weitzer, Stefan; Ardy, Rico Chandra; Krolo, Ana; Ijspeert, Hanna; Kiykim, Ayca; Karakoc-Aydiner, Elif; Förster-Waldl, Elisabeth; Kager, Leo; Pickl, Winfried F; Superti-Furga, Giulio; Martínez, Javier; Loizou, Joanna I; Ozen, Ahmet; van der Burg, Mirjam; Boztug, Kaan. Polymerase δ deficiency causes syndromic immunodeficiency with replicative stress. The Journal Of Clinical Investigation. 2019;129(10):4194-4206. 

Cui, Ye; Keles, Sevgi; Charbonnier, Louis-Marie; Julé, Amélie M; Henderson, Lauren; Celik, Seyma Celikbilek; Reisli, Ismail; Shen, Chen; Xie, Wen Jun; Schmitz-Abe, Klaus; Wu, Hao; Chatila, Talal A. Combined immunodeficiency caused by a loss-of-function mutation in DNA polymerase delta 1. The Journal Of Allergy And Clinical Immunology. 2020;145(1):391-401.e8. 

Layer, Jacob V; Debaize, Lydie; Van Scoyk, Alexandria; House, Nealia C; Brown, Alexander J; Liu, Yunpeng; Stevenson, Kristen E; Hemann, Michael; Roberts, Steven A; Price, Brendan D; Weinstock, David M; Day, Tovah A. Polymerase δ promotes chromosomal rearrangements and imprecise double-strand break repair. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2020;117(44):27566-27577.