Anti POLA1 pAb (ATL-HPA002947 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002947-25
Immunohistochemistry analysis in human lymph node and liver tissues using Anti-POLA1 antibody. Corresponding POLA1 RNA-seq data are presented for the same tissues.
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
ChIP-Exo-Seq composite graph for Anti-POLA1 (HPA002947, Lot A95954) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
Immunohistochemistry analysis in human lymph node and liver tissues using Anti-POLA1 antibody. Corresponding POLA1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymph node shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: polymerase (DNA directed), alpha 1, catalytic subunit
Gene Name: POLA1
Alternative Gene Name: NSX, p180, POLA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006678: 75%, ENSRNOG00000013322: 76%
Entrez Gene ID: 5422
Uniprot ID: P09884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVK
Gene Sequence VDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVK
Gene ID - Mouse ENSMUSG00000006678
Gene ID - Rat ENSRNOG00000013322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti POLA1 pAb (ATL-HPA002947 w/enhanced validation)
Datasheet Anti POLA1 pAb (ATL-HPA002947 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti POLA1 pAb (ATL-HPA002947 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti POLA1 pAb (ATL-HPA002947 w/enhanced validation)
Datasheet Anti POLA1 pAb (ATL-HPA002947 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti POLA1 pAb (ATL-HPA002947 w/enhanced validation)
Citations for Anti POLA1 pAb (ATL-HPA002947 w/enhanced validation) – 2 Found
Fujita, Toshitsugu; Asano, Yoshinori; Ohtsuka, Junko; Takada, Yoko; Saito, Kazunobu; Ohki, Rieko; Fujii, Hodaka. Identification of telomere-associated molecules by engineered DNA-binding molecule-mediated chromatin immunoprecipitation (enChIP). Scientific Reports. 2013;3( 24201379):3171.  PubMed
Starokadomskyy, Petro; Gemelli, Terry; Rios, Jonathan J; Xing, Chao; Wang, Richard C; Li, Haiying; Pokatayev, Vladislav; Dozmorov, Igor; Khan, Shaheen; Miyata, Naoteru; Fraile, Guadalupe; Raj, Prithvi; Xu, Zhe; Xu, Zigang; Ma, Lin; Lin, Zhimiao; Wang, Huijun; Yang, Yong; Ben-Amitai, Dan; Orenstein, Naama; Mussaffi, Huda; Baselga, Eulalia; Tadini, Gianluca; Grunebaum, Eyal; Sarajlija, Adrijan; Krzewski, Konrad; Wakeland, Edward K; Yan, Nan; de la Morena, Maria Teresa; Zinn, Andrew R; Burstein, Ezra. DNA polymerase-α regulates the activation of type I interferons through cytosolic RNA:DNA synthesis. Nature Immunology. 2016;17(5):495-504.  PubMed
!