Anti PNPLA5 pAb (ATL-HPA050409)

Atlas Antibodies

Catalog No.:
ATL-HPA050409-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: patatin-like phospholipase domain containing 5
Gene Name: PNPLA5
Alternative Gene Name: dJ388M5.4, GS2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018868: 66%, ENSRNOG00000022296: 63%
Entrez Gene ID: 150379
Uniprot ID: Q7Z6Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRFLERRGLTKEPVLWTLVSKEPPAPADGNWDAGCDQRWKGGLSLNWKVPHVQVKDVPNFEQ
Gene Sequence LRFLERRGLTKEPVLWTLVSKEPPAPADGNWDAGCDQRWKGGLSLNWKVPHVQVKDVPNFEQ
Gene ID - Mouse ENSMUSG00000018868
Gene ID - Rat ENSRNOG00000022296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PNPLA5 pAb (ATL-HPA050409)
Datasheet Anti PNPLA5 pAb (ATL-HPA050409) Datasheet (External Link)
Vendor Page Anti PNPLA5 pAb (ATL-HPA050409) at Atlas Antibodies

Documents & Links for Anti PNPLA5 pAb (ATL-HPA050409)
Datasheet Anti PNPLA5 pAb (ATL-HPA050409) Datasheet (External Link)
Vendor Page Anti PNPLA5 pAb (ATL-HPA050409)