Anti PNPLA2 pAb (ATL-HPA075175)

Atlas Antibodies

Catalog No.:
ATL-HPA075175-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: patatin like phospholipase domain containing 2
Gene Name: PNPLA2
Alternative Gene Name: ATGL, desnutrin, FP17548, iPLA2zeta, TTS-2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025509: 88%, ENSRNOG00000018736: 87%
Entrez Gene ID: 57104
Uniprot ID: Q96AD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA
Gene Sequence FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA
Gene ID - Mouse ENSMUSG00000025509
Gene ID - Rat ENSRNOG00000018736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PNPLA2 pAb (ATL-HPA075175)
Datasheet Anti PNPLA2 pAb (ATL-HPA075175) Datasheet (External Link)
Vendor Page Anti PNPLA2 pAb (ATL-HPA075175) at Atlas Antibodies

Documents & Links for Anti PNPLA2 pAb (ATL-HPA075175)
Datasheet Anti PNPLA2 pAb (ATL-HPA075175) Datasheet (External Link)
Vendor Page Anti PNPLA2 pAb (ATL-HPA075175)