Anti PNLIPRP3 pAb (ATL-HPA052009)

Atlas Antibodies

Catalog No.:
ATL-HPA052009-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: pancreatic lipase-related protein 3
Gene Name: PNLIPRP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025091: 47%, ENSRNOG00000017982: 45%
Entrez Gene ID: 119548
Uniprot ID: Q17RR3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYPCRSYTS
Gene Sequence KHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYPCRSYTS
Gene ID - Mouse ENSMUSG00000025091
Gene ID - Rat ENSRNOG00000017982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PNLIPRP3 pAb (ATL-HPA052009)
Datasheet Anti PNLIPRP3 pAb (ATL-HPA052009) Datasheet (External Link)
Vendor Page Anti PNLIPRP3 pAb (ATL-HPA052009) at Atlas Antibodies

Documents & Links for Anti PNLIPRP3 pAb (ATL-HPA052009)
Datasheet Anti PNLIPRP3 pAb (ATL-HPA052009) Datasheet (External Link)
Vendor Page Anti PNLIPRP3 pAb (ATL-HPA052009)