Anti PNLDC1 pAb (ATL-HPA052026)

Atlas Antibodies

Catalog No.:
ATL-HPA052026-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: poly(A)-specific ribonuclease (PARN)-like domain containing 1
Gene Name: PNLDC1
Alternative Gene Name: dJ195P10.2, FLJ40240
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073460: 92%, ENSRNOG00000023140: 92%
Entrez Gene ID: 154197
Uniprot ID: Q8NA58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT
Gene Sequence VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT
Gene ID - Mouse ENSMUSG00000073460
Gene ID - Rat ENSRNOG00000023140
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PNLDC1 pAb (ATL-HPA052026)
Datasheet Anti PNLDC1 pAb (ATL-HPA052026) Datasheet (External Link)
Vendor Page Anti PNLDC1 pAb (ATL-HPA052026) at Atlas Antibodies

Documents & Links for Anti PNLDC1 pAb (ATL-HPA052026)
Datasheet Anti PNLDC1 pAb (ATL-HPA052026) Datasheet (External Link)
Vendor Page Anti PNLDC1 pAb (ATL-HPA052026)