Anti PNLDC1 pAb (ATL-HPA052026)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052026-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PNLDC1
Alternative Gene Name: dJ195P10.2, FLJ40240
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073460: 92%, ENSRNOG00000023140: 92%
Entrez Gene ID: 154197
Uniprot ID: Q8NA58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT |
| Gene Sequence | VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT |
| Gene ID - Mouse | ENSMUSG00000073460 |
| Gene ID - Rat | ENSRNOG00000023140 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PNLDC1 pAb (ATL-HPA052026) | |
| Datasheet | Anti PNLDC1 pAb (ATL-HPA052026) Datasheet (External Link) |
| Vendor Page | Anti PNLDC1 pAb (ATL-HPA052026) at Atlas Antibodies |
| Documents & Links for Anti PNLDC1 pAb (ATL-HPA052026) | |
| Datasheet | Anti PNLDC1 pAb (ATL-HPA052026) Datasheet (External Link) |
| Vendor Page | Anti PNLDC1 pAb (ATL-HPA052026) |