Anti PNKD pAb (ATL-HPA010134 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA010134-25

Protein Description: paroxysmal nonkinesigenic dyskinesia
Gene Name: PNKD
Alternative Gene Name: BRP17, DKFZp564N1362, DYT8, FKSG19, FPD1, KIAA1184, KIPP1184, MGC31943, MR-1, PDC, PKND1, TAHCCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026179: 96%, ENSRNOG00000014806: 96%
Entrez Gene ID: 25953
Uniprot ID: Q8N490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA
• Gene Sequence: GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA
• Gene ID - Mouse: ENSMUSG00000026179
• Gene ID - Rat: ENSRNOG00000014806
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PNKD pAb (ATL-HPA010134 w/enhanced validation) – 2 Found

Signes, Alba; Cerutti, Raffaele; Dickson, Anna S; Benincá, Cristiane; Hinchy, Elizabeth C; Ghezzi, Daniele; Carrozzo, Rosalba; Bertini, Enrico; Murphy, Michael P; Nathan, James A; Viscomi, Carlo; Fernandez-Vizarra, Erika; Zeviani, Massimo. APOPT1/COA8 assists COX assembly and is oppositely regulated by UPS and ROS. Embo Molecular Medicine. 2019;11(1) 

Sadegh, Mardjaneh Karbalaei; Ekman, Mari; Krawczyk, Katarzyna; Svensson, Daniel; Göransson, Olga; Dahan, Diana; Nilsson, Bengt-Olof; Albinsson, Sebastian; Uvelius, Bengt; Swärd, Karl. Detrusor induction of miR-132/212 following bladder outlet obstruction: association with MeCP2 repression and cell viability. Plos One. 10(1):e0116784.