Anti PMS2 pAb (ATL-HPA070310)

Atlas Antibodies

Catalog No.:
ATL-HPA070310-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: PMS1 homolog 2, mismatch repair system component
Gene Name: PMS2
Alternative Gene Name: HNPCC4, H_DJ0042M02.9, MLH4, PMSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079109: 58%, ENSRNOG00000001040: 48%
Entrez Gene ID: 5395
Uniprot ID: P54278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRS
Gene Sequence MHAADLEKPMVEKQDQSPSLRTGEEKKDVSISRLREAFSLRHTTENKPHSPKTPEPRRS
Gene ID - Mouse ENSMUSG00000079109
Gene ID - Rat ENSRNOG00000001040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PMS2 pAb (ATL-HPA070310)
Datasheet Anti PMS2 pAb (ATL-HPA070310) Datasheet (External Link)
Vendor Page Anti PMS2 pAb (ATL-HPA070310) at Atlas Antibodies

Documents & Links for Anti PMS2 pAb (ATL-HPA070310)
Datasheet Anti PMS2 pAb (ATL-HPA070310) Datasheet (External Link)
Vendor Page Anti PMS2 pAb (ATL-HPA070310)