Anti PMS2 pAb (ATL-HPA066490)

Atlas Antibodies

Catalog No.: ATL-HPA066490-25

Protein Description: PMS1 homolog 2, mismatch repair system component
Gene Name: PMS2
Alternative Gene Name: HNPCC4, H_DJ0042M02.9, MLH4, PMSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079109: 45%, ENSRNOG00000001040: 47%
Entrez Gene ID: 5395
Uniprot ID: P54278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AISDKGVLRPQKEAVSSSQGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEC
• Gene Sequence: AISDKGVLRPQKEAVSSSQGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEC
• Gene ID - Mouse: ENSMUSG00000079109
• Gene ID - Rat: ENSRNOG00000001040
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.