Anti PMS2 pAb (ATL-HPA066490)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066490-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PMS2
Alternative Gene Name: HNPCC4, H_DJ0042M02.9, MLH4, PMSL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079109: 45%, ENSRNOG00000001040: 47%
Entrez Gene ID: 5395
Uniprot ID: P54278
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AISDKGVLRPQKEAVSSSQGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEC |
Gene Sequence | AISDKGVLRPQKEAVSSSQGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEC |
Gene ID - Mouse | ENSMUSG00000079109 |
Gene ID - Rat | ENSRNOG00000001040 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PMS2 pAb (ATL-HPA066490) | |
Datasheet | Anti PMS2 pAb (ATL-HPA066490) Datasheet (External Link) |
Vendor Page | Anti PMS2 pAb (ATL-HPA066490) at Atlas Antibodies |
Documents & Links for Anti PMS2 pAb (ATL-HPA066490) | |
Datasheet | Anti PMS2 pAb (ATL-HPA066490) Datasheet (External Link) |
Vendor Page | Anti PMS2 pAb (ATL-HPA066490) |