Anti PMS1 pAb (ATL-HPA031013)

Atlas Antibodies

Catalog No.:
ATL-HPA031013-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: PMS1 homolog 1, mismatch repair system component
Gene Name: PMS1
Alternative Gene Name: MLH2, PMSL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026098: 64%, ENSRNOG00000004076: 65%
Entrez Gene ID: 5378
Uniprot ID: P54277
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSS
Gene Sequence ESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSS
Gene ID - Mouse ENSMUSG00000026098
Gene ID - Rat ENSRNOG00000004076
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PMS1 pAb (ATL-HPA031013)
Datasheet Anti PMS1 pAb (ATL-HPA031013) Datasheet (External Link)
Vendor Page Anti PMS1 pAb (ATL-HPA031013) at Atlas Antibodies

Documents & Links for Anti PMS1 pAb (ATL-HPA031013)
Datasheet Anti PMS1 pAb (ATL-HPA031013) Datasheet (External Link)
Vendor Page Anti PMS1 pAb (ATL-HPA031013)