Anti PMPCB pAb (ATL-HPA074168)

Atlas Antibodies

Catalog No.:
ATL-HPA074168-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: peptidase (mitochondrial processing) beta
Gene Name: PMPCB
Alternative Gene Name: MPPB, MPPP52
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029017: 85%, ENSRNOG00000012693: 86%
Entrez Gene ID: 9512
Uniprot ID: O75439
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLR
Gene Sequence SEVARARNLLKTNMLLQLDGSTPICEDIGRQMLCYNRRIPIPELEARIDAVNAETIREVCTKYIYNRSPAIAAVGPIKQLPDFKQIRSNMCWLR
Gene ID - Mouse ENSMUSG00000029017
Gene ID - Rat ENSRNOG00000012693
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PMPCB pAb (ATL-HPA074168)
Datasheet Anti PMPCB pAb (ATL-HPA074168) Datasheet (External Link)
Vendor Page Anti PMPCB pAb (ATL-HPA074168) at Atlas Antibodies

Documents & Links for Anti PMPCB pAb (ATL-HPA074168)
Datasheet Anti PMPCB pAb (ATL-HPA074168) Datasheet (External Link)
Vendor Page Anti PMPCB pAb (ATL-HPA074168)