Anti PML pAb (ATL-HPA008312)

Atlas Antibodies

Catalog No.: ATL-HPA008312-25

Protein Description: promyelocytic leukemia
Gene Name: PML
Alternative Gene Name: MYL, RNF71, TRIM19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036986: 80%, ENSRNOG00000008400: 80%
Entrez Gene ID: 5371
Uniprot ID: P29590
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLP
• Gene Sequence: ISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLP
• Gene ID - Mouse: ENSMUSG00000036986
• Gene ID - Rat: ENSRNOG00000008400
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PML pAb (ATL-HPA008312) – 3 Found

Chan, Chii J; Li, Wenhong; Cojoc, Gheorghe; Guck, Jochen. Volume Transitions of Isolated Cell Nuclei Induced by Rapid Temperature Increase. Biophysical Journal. 2017;112(6):1063-1076. 

Campagna, M; Herranz, D; Garcia, M A; Marcos-Villar, L; González-Santamaría, J; Gallego, P; Gutierrez, S; Collado, M; Serrano, M; Esteban, M; Rivas, C. SIRT1 stabilizes PML promoting its sumoylation. Cell Death And Differentiation. 2011;18(1):72-9. 

Stepp, Wesley H; Meyers, Jordan M; McBride, Alison A. Sp100 provides intrinsic immunity against human papillomavirus infection. Mbio. 2013;4(6):e00845-13.