Anti PMF1 pAb (ATL-HPA071854)

Atlas Antibodies

Catalog No.:
ATL-HPA071854-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polyamine-modulated factor 1
Gene Name: PMF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028066: 85%, ENSRNOG00000019620: 84%
Entrez Gene ID: 11243
Uniprot ID: Q6P1K2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAP
Gene Sequence MTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAP
Gene ID - Mouse ENSMUSG00000028066
Gene ID - Rat ENSRNOG00000019620
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PMF1 pAb (ATL-HPA071854)
Datasheet Anti PMF1 pAb (ATL-HPA071854) Datasheet (External Link)
Vendor Page Anti PMF1 pAb (ATL-HPA071854) at Atlas Antibodies

Documents & Links for Anti PMF1 pAb (ATL-HPA071854)
Datasheet Anti PMF1 pAb (ATL-HPA071854) Datasheet (External Link)
Vendor Page Anti PMF1 pAb (ATL-HPA071854)