Anti PMEPA1 pAb (ATL-HPA072291)

Atlas Antibodies

Catalog No.:
ATL-HPA072291-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: prostate transmembrane protein, androgen induced 1
Gene Name: PMEPA1
Alternative Gene Name: STAG1, TMEPAI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038400: 88%, ENSRNOG00000050404: 86%
Entrez Gene ID: 56937
Uniprot ID: Q969W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE
Gene Sequence VNSTAAAAAGQPNVSCTCNCKRSLFQSMEITELE
Gene ID - Mouse ENSMUSG00000038400
Gene ID - Rat ENSRNOG00000050404
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PMEPA1 pAb (ATL-HPA072291)
Datasheet Anti PMEPA1 pAb (ATL-HPA072291) Datasheet (External Link)
Vendor Page Anti PMEPA1 pAb (ATL-HPA072291) at Atlas Antibodies

Documents & Links for Anti PMEPA1 pAb (ATL-HPA072291)
Datasheet Anti PMEPA1 pAb (ATL-HPA072291) Datasheet (External Link)
Vendor Page Anti PMEPA1 pAb (ATL-HPA072291)