Anti PM20D2 pAb (ATL-HPA030327)

Atlas Antibodies

Catalog No.: ATL-HPA030327-25

Protein Description: peptidase M20 domain containing 2
Gene Name: PM20D2
Alternative Gene Name: ACY1L2, bA63L7.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054659: 84%, ENSRNOG00000007755: 84%
Entrez Gene ID: 135293
Uniprot ID: Q8IYS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIREDFKLKLQEEQFVN
• Gene Sequence: FVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIREDFKLKLQEEQFVN
• Gene ID - Mouse: ENSMUSG00000054659
• Gene ID - Rat: ENSRNOG00000007755
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.