Anti PM20D2 pAb (ATL-HPA030326)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030326-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: PM20D2
Alternative Gene Name: ACY1L2, bA63L7.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054659: 90%, ENSRNOG00000007755: 90%
Entrez Gene ID: 135293
Uniprot ID: Q8IYS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWR |
| Gene Sequence | AFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWR |
| Gene ID - Mouse | ENSMUSG00000054659 |
| Gene ID - Rat | ENSRNOG00000007755 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PM20D2 pAb (ATL-HPA030326) | |
| Datasheet | Anti PM20D2 pAb (ATL-HPA030326) Datasheet (External Link) |
| Vendor Page | Anti PM20D2 pAb (ATL-HPA030326) at Atlas Antibodies |
| Documents & Links for Anti PM20D2 pAb (ATL-HPA030326) | |
| Datasheet | Anti PM20D2 pAb (ATL-HPA030326) Datasheet (External Link) |
| Vendor Page | Anti PM20D2 pAb (ATL-HPA030326) |