Anti PM20D2 pAb (ATL-HPA030326)

Atlas Antibodies

Catalog No.:
ATL-HPA030326-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: peptidase M20 domain containing 2
Gene Name: PM20D2
Alternative Gene Name: ACY1L2, bA63L7.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054659: 90%, ENSRNOG00000007755: 90%
Entrez Gene ID: 135293
Uniprot ID: Q8IYS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWR
Gene Sequence AFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWR
Gene ID - Mouse ENSMUSG00000054659
Gene ID - Rat ENSRNOG00000007755
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PM20D2 pAb (ATL-HPA030326)
Datasheet Anti PM20D2 pAb (ATL-HPA030326) Datasheet (External Link)
Vendor Page Anti PM20D2 pAb (ATL-HPA030326) at Atlas Antibodies

Documents & Links for Anti PM20D2 pAb (ATL-HPA030326)
Datasheet Anti PM20D2 pAb (ATL-HPA030326) Datasheet (External Link)
Vendor Page Anti PM20D2 pAb (ATL-HPA030326)