Anti PLXNA3 pAb (ATL-HPA058989)

Atlas Antibodies

SKU:
ATL-HPA058989-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus, cell junctions & vesicles.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: plexin A3
Gene Name: PLXNA3
Alternative Gene Name: 6.3, Plxn3, PLXN4, SEX, XAP-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031398: 84%, ENSRNOG00000060464: 86%
Entrez Gene ID: 55558
Uniprot ID: P51805
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA
Gene Sequence SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA
Gene ID - Mouse ENSMUSG00000031398
Gene ID - Rat ENSRNOG00000060464
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PLXNA3 pAb (ATL-HPA058989)
Datasheet Anti PLXNA3 pAb (ATL-HPA058989) Datasheet (External Link)
Vendor Page Anti PLXNA3 pAb (ATL-HPA058989) at Atlas Antibodies

Documents & Links for Anti PLXNA3 pAb (ATL-HPA058989)
Datasheet Anti PLXNA3 pAb (ATL-HPA058989) Datasheet (External Link)
Vendor Page Anti PLXNA3 pAb (ATL-HPA058989)